PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462926287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 544aa    MW: 61076.4 Da    PI: 9.4988
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462926287genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.94.2e-143183881586
                -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                 ++lp++f++++g ++++ +tl+    s + W+v+  ++ + g+y l++GWk F+++ +L+egD++++ +++
  462926287 318 TMTLPRPFCNAIGFQEPCMITLQASMDSTKLWQVQG-HTYNTGSYQLGSGWKLFCRDTRLREGDILTINVIQ 388
                689**********9999998888888999******9.6888889***********************98765 PP

2B353.64e-17447528285
                EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS.-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE- CS
         B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esg.rsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkld 85 
                +k+ ++ ++ +  rl+lp  f++++g+++++   + l++ + g rsW+v ++   +++r +  t+GWk+F+++n+Lk+gD ++F  +
  462926287 447 VKKKINTSAIED-RLSLPAVFCDAIGLQETCL--INLKSsLCGaRSWQVCVS--PNKNRsHRVTAGWKRFCQENELKVGDACTFNIV 528
                677777777765.6**************8885..6666633336*******4..444444999*********************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.3E-12138236IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.064138234IPR003340B3 DNA binding domain
CDDcd100172.11E-7139231No hitNo description
SuperFamilySSF1019369.61E-15139236IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0017141234IPR003340B3 DNA binding domain
SMARTSM010190.24311401IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-13313398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-13315398IPR015300DNA-binding pseudobarrel domain
CDDcd100174.18E-8317384No hitNo description
PfamPF023621.4E-10318388IPR003340B3 DNA binding domain
PROSITE profilePS5086310.588319400IPR003340B3 DNA binding domain
SuperFamilySSF1019363.53E-15442529IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.293445544IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-17448531IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0029448538IPR003340B3 DNA binding domain
PfamPF023627.5E-14448529IPR003340B3 DNA binding domain
CDDcd100171.74E-11456525No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MASSGDPGAT AARKHLRVLL PFSRSSLVRE MFSRLRHAPK EAEPTDLARL QRIPDELAGE  60
IGGGEALVFV PSGGKRFWPV EVGQDDDGAF LGRGGQAFRV GRGVLTVKAF DDSGCVRKLG  120
APVPPPAEET VSSKARFKPQ FIRVFPQDSM EKMLLPAKFV QHYILKEHLN NCMAFIFVPL  180
GKICQIELKM NQSDMFFAGG WSQFLSFHNI TGPNTLLLRY EGSMVFTVKV FEPNGCLRGP  240
KHKDIRMQQT KLAESEQLPE TPPLSIQNHK SKHDWPSNEG EGQKKPKGSM TILKKRSKIY  300
CVYDIGPPAW MKKKVDFTMT LPRPFCNAIG FQEPCMITLQ ASMDSTKLWQ VQGHTYNTGS  360
YQLGSGWKLF CRDTRLREGD ILTINVIQTT LWQVVITRGK ENINQSYHAH ETPSNSRGEK  420
RPNYGSLTNL EHAKPRCIFE IGPPAWVKKK INTSAIEDRL SLPAVFCDAI GLQETCLINL  480
KSSLCGARSW QVCVSPNKNR SHRVTAGWKR FCQENELKVG DACTFNIVET RLWESSFDIV  540
AEMV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975298.11e-125PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X1
TrEMBLA0A0A9S1931e-169A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012530m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.16e-12B3 family protein